Products

FGF-9 (Fibroblast growth factor-9), Human

FGF-9 (fibroblast growth factor-9), also called HBGF-9 (heparin-binding growth factor-9) and GAF (glia-activating factor), is an approximately 26 kDa secreted glycoprotein of the FGF family (1-3). FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration.
No. Size Price Qty Status
C01099-5UG 5 ug $108.00 Inquiry
C01099-20UG 20 ug $268.00 Inquiry
C01099-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGI
LEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFL
PRPVDPDKVPELYK DILSQS with polyhistidine tag at the C-terminus
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE. 
 
Form:
Lyophilized
 
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
 
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Reviews for FGF-9 (Fibroblast growth factor-9), Human

Average Rating: 0 (0 Reviews )